PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678439025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 598aa    MW: 65314.8 Da    PI: 5.5034
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678439025genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.3e-093984351954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   n+yp+ +++  LA+++gLt +qV++WF N R +
  678439025 398 FEHflNPYPKDSDKIMLARQTGLTRCQVSNWFINARVR 435
                665569******************************88 PP

2BELL1092.8e-35260331172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                e+qel+++ ++Ll ll+ Vd+rY+qy +q+q+++ssF+  ag g+akpYtslAl++iSrhFr+L+dai  qi
  678439025 260 EKQELHSRLTQLLVLLDDVDRRYRQYSHQMQMIVSSFDSTAGSGAAKPYTSLALQTISRHFRSLRDAINRQI 331
                689******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-47181329IPR006563POX domain
PfamPF075261.8E-44187327IPR006563POX domain
PROSITE profilePS5007112.179376439IPR001356Homeobox domain
CDDcd000868.44E-13379440No hitNo description
SMARTSM003891.4E-9379443IPR001356Homeobox domain
SuperFamilySSF466891.5E-17380446IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-28382445IPR009057Homeodomain-like
PfamPF059206.9E-18396435IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MDAFFPMPSN QTEAETLVYL RESLPNSQSE TPLRPSDVVA YMNCPSTSGP YAGGLPENSQ  60
SQASCINLHS DSNICHQEFL LNFEGSGAEQ SHLSTWGAAS GVLQGLSLTL GPHTPPVMQF  120
PGVRYRKDNP NVASVLGLGA LVRDEDGGKS TPIEAEDDVQ NKQFSSVANT GSDVVPIYEM  180
MNIASAVSSS KYLKAAQQLL DEVVNVKRDI KDRNYKKELR TTAKEGDGEP ETASSDPSAM  240
ASSFSPKAGG SSTIQLSGSE KQELHSRLTQ LLVLLDDVDR RYRQYSHQMQ MIVSSFDSTA  300
GSGAAKPYTS LALQTISRHF RSLRDAINRQ IHVARRSLGE EDASSTEKVI GISRLRYVDR  360
NMRQQRVLQQ LGLMHQQAWR PQRGLPETSV SILRAWLFEH FLNPYPKDSD KIMLARQTGL  420
TRCQVSNWFI NARVRLWKPM IEEMYKEELG DVDIDSNSSS EASQTPGKSA TNSTADKFEN  480
PSNHTTSTSL QPESTVASIG TSTNPLPESN SGDNGGLTSL VEFQIPKRCR NINEISLTLG  540
LQQGELRPTS ILDGTGHGFL HLRDNNVVNP AASGMAAEAA EFDSMDSGNL ASPLPSIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16385443563Homeobox protein Meis2
3k2a_B4e-16385443563Homeobox protein Meis2
4xrs_A4e-16385442158Homeobox protein Meis1
4xrs_B4e-16385442158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088451.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotO656851e-108BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLM1D1Z21e-163M1D1Z2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000795171e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102052226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.12e-97BEL1-like homeodomain 7